acarmendariz2005 acarmendariz2005

10-03-2021
History

contestada

The main purpose of the British blockade was to prevent military goods and food from getting through to Germany.
True or False???

Respuesta :

dyzziepanda1 dyzziepanda1

10-03-2021

True the Blockade was to block enemy ports in hope to cut off all supplies from the outside world !

Answer Link

Otras preguntas

Write the correct answer to a false statement

Sally consumed 2.5 gallons of water in one day. How many milliliters are equal to 2.5 gallons, if 1 liter = 1,000 milliliters and 1 gallon = 3.785 liters?ial fa

List three important state matters that are overseen by committees of the Texas Senate.

Please help 50 points!! Identify the gross domestic product of a) one free market economy and b) one planned economy of your choice (in $) Reference index of

The oligopeptide MNQSYGRLVSRAAIAATAMASLIKIFAWWY was cleaved by reaction with trypsin. Trypsin is a serine protease that hydrolyses peptide chains at the protein

Write a summary of today's passage

Leo has d stamps and Pete has 2 times as many. How many more stamps does Pete have than Leo?i dont get it-

who is the speaker of grateful never give up

Aaron's friend drove him from Buffalo to Cleveland the distance is 187 miles and the trip took 2.75 hours how fast was Aaron's friend driving

Why did some of the founding fathers wanna add to a bill of rights into constitution